PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_70929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 316aa    MW: 35624.4 Da    PI: 6.6343
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_70929.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.71.9e-52301581128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                   lppGfrFhPtd+elvv+yL++kv+g++ ++  +i+evd+yk++PwdLp+++  +++ewyfF++rd+ky++g+r+nr++ +gyWkatg dk+v  +  
  MLOC_70929.1  30 LPPGFRFHPTDDELVVHYLCRKVAGQPQPV-PIIAEVDLYKFNPWDLPERALFGSREWYFFTPRDRKYPNGSRPNRSAGTGYWKATGADKPVAPRes 125
                   79*************************999.88***************8777899*************************************99877 PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +g++vg+kk Lvfy+grap+g+ktdW+mheyr+
  MLOC_70929.1 126 GGRTVGIKKALVFYSGRAPRGVKTDWIMHEYRI 158
                   8999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-6426184IPR003441NAC domain
PROSITE profilePS5100561.79930184IPR003441NAC domain
PfamPF023653.9E-2731158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MMTAMVKAEA MTAEAEGSSG RRDAEAELNL PPGFRFHPTD DELVVHYLCR KVAGQPQPVP  60
IIAEVDLYKF NPWDLPERAL FGSREWYFFT PRDRKYPNGS RPNRSAGTGY WKATGADKPV  120
APRESGGRTV GIKKALVFYS GRAPRGVKTD WIMHEYRIAQ ADRTPGKKGS LKLDEWVLCR  180
LYNKKNNWDK VKVEQDMAVV QGQNGEVMDA LATDAMSDSF QTHDSSEIDN ASGLQQQHHG  240
FMDMAQRQAR EGMVTVKEDS DWFTGLSMDD LQTCYMNMGQ MVNPAAMPVH DGSGYLQSMN  300
SPQMMRPMWQ TILPPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-99171902174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649580.0AK364958.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2029L14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564478.10.0PREDICTED: NAC domain-containing protein 68-like
SwissprotQ52QH41e-158NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLF2DM400.0F2DM40_HORVD; Predicted protein
STRINGMLOC_70929.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.17e-86NAC domain containing protein 102